PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G208200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 256aa    MW: 28420.8 Da    PI: 5.1717
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G208200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.71.5e-141461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++lv      G  +W+++++   + R++k+c++rw +yl
  Sevir.2G208200.1.p 14 KGPWTAEEDQKLVSFLLNNGQCCWRAVPKLARLLRCGKSCRLRWTNYL 61
                        79******************************99************97 PP

2Myb_DNA-binding551.9e-1770111447
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          ++eE++  vd++++lG++ W++Ia+ ++ gRt++++k++w+++
  Sevir.2G208200.1.p  70 LSPEEEKTVVDLHAELGNR-WSKIASQLP-GRTDNEIKNHWNTH 111
                         69*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-19562IPR009057Homeodomain-like
PROSITE profilePS5129413.046961IPR017930Myb domain
SuperFamilySSF466892.43E-2611108IPR009057Homeodomain-like
SMARTSM007171.2E-101363IPR001005SANT/Myb domain
PfamPF002493.0E-131461IPR001005SANT/Myb domain
CDDcd001672.29E-71661No hitNo description
PROSITE profilePS5129426.00662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-2563116IPR009057Homeodomain-like
SMARTSM007177.4E-1566114IPR001005SANT/Myb domain
PfamPF002491.8E-1570111IPR001005SANT/Myb domain
CDDcd001672.06E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLVSFLL NNGQCCWRAV PKLARLLRCG KSCRLRWTNY  60
LRPDLKRGLL SPEEEKTVVD LHAELGNRWS KIASQLPGRT DNEIKNHWNT HIKEKLRKMG  120
IDPATHKPLQ SAPPPPQDPT GSPEEKAVSG AGPGHEVPVV NLLDDIDIST AYSPEPLSSS  180
SSSSSSSSYY YSSATASSGG SSIVDGEWPE WPQMVEWPES IWLDDVVTTG PTSWEFEDPF  240
ITFQSIELFS HQDTW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0837351e-146BT083735.2 Zea mays full-length cDNA clone ZM_BFb0033K01 mRNA, complete cds.
GenBankBT0855211e-146BT085521.2 Zea mays full-length cDNA clone ZM_BFc0028P12 mRNA, complete cds.
GenBankBT0856251e-146BT085625.2 Zea mays full-length cDNA clone ZM_BFc0040A03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956765.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX62e-82ODO1_PETHY; Protein ODORANT1
TrEMBLK4A1031e-164K4A103_SETIT; Uncharacterized protein
STRINGSi032544m1e-164(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.11e-81myb domain protein 20